SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s07320.1|PACid:18217161 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s07320.1|PACid:18217161
Domain Number 1 Region: 660-679,739-988
Classification Level Classification E-value
Superfamily HAD-like 4.49e-62
Family Meta-cation ATPase, catalytic domain P 0.00017
Further Details:      
 
Domain Number 2 Region: 462-547
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.72e-23
Family Calcium ATPase, transduction domain A 0.0029
Further Details:      
 
Domain Number 3 Region: 135-209
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 7.59e-20
Family HMA, heavy metal-associated domain 0.00033
Further Details:      
 
Domain Number 4 Region: 56-127
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.49e-19
Family HMA, heavy metal-associated domain 0.00063
Further Details:      
 
Domain Number 5 Region: 400-445,548-655,931-971
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000288
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 
Weak hits

Sequence:  POPTR_0003s07320.1|PACid:18217161
Domain Number - Region: 209-271
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00112
Family HMA, heavy metal-associated domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s07320.1|PACid:18217161
Sequence length 1008
Sequence
MRDLQLTQVAGTRQSPLAMVYTDDMMEDVRLLDSCESRDDHNDGSHAIVIGEVGSKRIQV
RVTGMTCAACSNSVESALKSVHGVFRASVALLQNKADVVFDPALVKDDDIKNAIEDAGFE
AEILSEPSILKTKPNGTLLGQFTIGGMTCAACVNSVEGILRNRPGVKRAVVALATSLGEV
EYDPTVISKDDIVNAIEDAGFDASLVQSSQQDKILLGVAGIFSEMDVQLLEGILIMLKGV
RQFRYNQLSSELEVLFDPEVVGSRSLVDGVEGGSNGKFKLHVINPYSRMTSKDVGEISVM
FRLFISSLFLSIPIFFMRVICPHIPLLYSLLLWRCGPFLMGDWLKWALVSVVQFVIGKRF
YVAAGRALRNGSTNMDVLVALGTSASYFYSVCALLYGAVTGLWSPTYFETSSMLITFVLL
GKYLECLAKGKTSDAIKKLVQLAPATALLVVKDKGGKSIGEREIDSLLIQPGDILKVPPG
TKVPADGVVVRGSSHVNESMVTGESAPVLKEASSSVIGGTINLHGALHIQATKVGSDAVL
SQIISLVETAQMSKAPIQKFADYVASIFVPTVVGLALVTLFSWYISGISGAYPEEWLPEN
GNYFVFSLMFSISVVVIACPCALGLATPTAVMVATGVGANHGVLIKGGDALERAQKIKYV
ILDKTGTLTQGKATVTDVKVFTGMGRGEFLGWVASAEASSEHPLAKAIVEHARHFHSFDE
PPATNDGQTPSKGSTISGWLLDVSDFLAHPGSGVKCFIDGKRILVGNRKLMTESGIAIPD
QVENFVVELEESAKTGVLVAFDDNIIGILGIADPLKREAAVVIEGLLKMGVKPVMVTGDN
WRTARAVAKEVGIQDVRAEVMPAGKADVIQSFQKDGSIVAMVGDGINDSPALAAADVGMA
IGAGTDIAIEAADYVLMRNNLEDVITAIDLSRKTFSRIRLNYIFAMGYNVIAIPIAAGMF
FPSLGIMLPPWAAGACMALSSVSVVCSSLLLRRYRKPRLTTILEITVD
Download sequence
Identical sequences B9GYA1
XP_002303349.2.11743 POPTR_0003s07320.1|PACid:18217161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]