SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s07840.1|PACid:18217756 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s07840.1|PACid:18217756
Domain Number 1 Region: 17-134,231-325,638-858
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-81
Family Calcium ATPase, transmembrane domain M 0.0039
Further Details:      
 
Domain Number 2 Region: 327-383,420-636
Classification Level Classification E-value
Superfamily HAD-like 3.23e-38
Family Meta-cation ATPase, catalytic domain P 0.00072
Further Details:      
 
Domain Number 3 Region: 134-231
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.62e-30
Family Calcium ATPase, transduction domain A 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s07840.1|PACid:18217756
Sequence length 961
Sequence
MDNTANALEAISKETVDLENVPIEEVFEKLKCTKEGLSDDDVQKRLGVFGYNKLEEKKES
KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKGTDYHDFIGILTLLIINSTISFIEENN
AGNAAAALMARLAPKAKVLRDGKWREEEAAELVPGDIVSIKLGDIIPADARLLEGDPLKI
DQSALTGESLPVTKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVENTTHVGHF
QKVLTAIGNFCICSIAIGMLIEIIVMYGIQGRAYRVGIDNLLVLLIGGIPIAMPTVLSVT
MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFSKEVDKD
MVVLMAARASRLENQDAIDAAIVSMLADPKEARAGITEVHFLPFNPTDKRTALTYLDSAG
KMHRVSKGAPEQILNLAWNKSDIERRVHSIIDKFAERGLRSLGVARQEVPAGNKDSPGGP
WEFVGLLPLFDPPRHDSAETIRRALDLGVSVKMITGDQLAIGKETGRRLGMGTNMYPSSS
LLGENKDGVGALPIDELIENADGFAGVFPEHKYEIVKRLQAKKHIVGMTGDGVNDAPALK
IADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV
MGFMLLAVFWKFDFPPFMVLIIAVLNDGTIMTISKDRVKPSPIPDCWKLSEIFATGIVIG
SYLAVMTVVFFWMAFKTDFFPKHFHVKSFNQHLDLSDKVLSKELNGQLASAVYLQVSTIS
QALIFVTRSRSWSYKERPGLLLLSAFIIAQLVNASKLATTWDFAGISKIGWRWTAVIWLY
NIVTYKLLDPIKFAVRYAQSGRAWSLVYNQRTAMTTQKDFGKEARKAAWAAEQRTLHGLQ
SMEAKSFSEKHTFRDINIMAEEARRRAEIARLRELHTLKGKVESIAKLRGLDIDVNPHYT
V
Download sequence
Identical sequences B9GYM5
3694.fgenesh4_pg.C_LG_III000605 POPTR_0003s07840.1|PACid:18217756 XP_002304299.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]