SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s08330.1|PACid:18216687 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s08330.1|PACid:18216687
Domain Number 1 Region: 133-206
Classification Level Classification E-value
Superfamily SNARE fusion complex 7.85e-18
Family SNARE fusion complex 0.0028
Further Details:      
 
Weak hits

Sequence:  POPTR_0003s08330.1|PACid:18216687
Domain Number - Region: 6-65
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00209
Family Occludin/ELL domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s08330.1|PACid:18216687
Sequence length 266
Sequence
MDPLSSISEELAEINGQIADIFRALSNGFQKLEKIKDVNRQSRQLEELTGKLRECKRLIK
EFDREMKDMESRNDPDTNKMLNEKKQSMIKELNSYVALKKQYATNLENNKRVDLFDGPNE
ELHDDNVLLASSMTNQQLVDHGNQMMDETDQAIERGKKVVQDTINVGTETAAALKAQTEQ
MSRIVNELDSIHFSIKKASQLVKEIGRQVATDKCIMALLFLIVVGVIAIIIVKLVNPSNK
DIRDIPGLAPPAPSRRLLWIPNQETS
Download sequence
Identical sequences B9N2U3
XP_006385586.1.11743 POPTR_0003s08330.1|PACid:18216687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]