SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s12570.1|PACid:18217587 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s12570.1|PACid:18217587
Domain Number 1 Region: 652-671,715-963
Classification Level Classification E-value
Superfamily HAD-like 1.21e-56
Family Meta-cation ATPase, catalytic domain P 0.00016
Further Details:      
 
Domain Number 2 Region: 123-195
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.62e-21
Family HMA, heavy metal-associated domain 0.00071
Further Details:      
 
Domain Number 3 Region: 453-539
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 8.89e-20
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 4 Region: 45-118
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 9.82e-20
Family HMA, heavy metal-associated domain 0.00074
Further Details:      
 
Domain Number 5 Region: 401-437,540-647,907-939
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000114
Family Calcium ATPase, transmembrane domain M 0.0096
Further Details:      
 
Domain Number 6 Region: 196-263
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000119
Family HMA, heavy metal-associated domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s12570.1|PACid:18217587
Sequence length 987
Sequence
MATKFLALACIRKESTYGDLSPRPRYPSMPKYPKGVSVRETNVEGSEAKAVFSVMGMTCS
ACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSFVNEETIRETIEDAGFEATLIQEGT
SDRSTQVCRIRINGMTCTSCSSTVEQALQAIPGVQKAQVALATEEAEVHYDPNILSYNQI
LEAINDTGFEAILLSTGVDMSKIGLKIVGVRTQNSMRIIENSLQALPGVQSVDIDPEVNK
ISLSYKPDVTGPRNFINVIESTGTSGRFKATIFPEGGGRESHRQEEIKQYYRSFLWSLVF
TVPVFLISMIFMYIPGIKHALDTKIVNMLSIGAILRWVLSTPVQFIIGRRFYTGSYKALR
NGSPNMDVLIALGTNAAYFYSVYSVLRSATSPSFESADFFETSSMLISFILLGKYLEVLA
KGKTSEAIAKLMDLAPGTAILLTLDDQGNVSSEEEIDSRLIQRNDVIKIIPGAKIASDGF
VIWGQSHVNESMITGEARPVAKRKGDTVIGGTVNENGVLHIKATRVGSESALSQIVRLVE
SAQMAKAPVQKFADRISRYFVPLVIILSFSTWLAWFLAGKFHGYPGSWIPKSMDSFQLAL
QFGISVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQALESAHKVNCIVFDKTGTL
TIGKPLVVSTRLLKNLALRDFYELVAAAEVNSEHPLAKAIVEYAKKFREDEESPKWPEAQ
DFESITGHGVKAIVRNKEVIVGNKSLMLENNIPISIDAEEILAETEGMAQTGILVSIDRE
VTGVLAISDPLKPGAHEVISILKSMKVRSIMVTGDNWGTAHSIAREVGIETVIAEAKPEH
KAEKVKELQAAGYIVAMVGDGINDSPALVVADVGMAIGAGTDIAIEAADIVLMKSNLEDV
ITAIDLSRKTFFRIRLNYIWALGYNLLGIPIAAGALFPGTGFRLPPWIAGAAMAASSVSV
VVCSLLLKNYKRPKKLENLDIGGIMIE
Download sequence
Identical sequences B9GWH1
3694.eugene3.00030979 XP_002303580.1.11743 POPTR_0003s12570.1|PACid:18217587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]