SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s12580.1|PACid:18217545 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s12580.1|PACid:18217545
Domain Number 1 Region: 648-667,711-960
Classification Level Classification E-value
Superfamily HAD-like 2.09e-55
Family Meta-cation ATPase, catalytic domain P 0.00014
Further Details:      
 
Domain Number 2 Region: 449-535
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.62e-19
Family Calcium ATPase, transduction domain A 0.0058
Further Details:      
 
Domain Number 3 Region: 43-115
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.67e-18
Family HMA, heavy metal-associated domain 0.00088
Further Details:      
 
Domain Number 4 Region: 122-193
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000000537
Family HMA, heavy metal-associated domain 0.00095
Further Details:      
 
Domain Number 5 Region: 397-433,536-643,903-942
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000366
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 
Domain Number 6 Region: 194-262
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000183
Family HMA, heavy metal-associated domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s12580.1|PACid:18217545
Sequence length 983
Sequence
MATMFLKLTCLRRENCGDLLARPHYPSMPKYPKGVAGDVKGTEVKAMFSVTGMTCSACAG
SVEKAIKRLPGILEAVVDVLNNRAQVLFYPSSLVNEETIRETIEDAGFQATLIEDEINER
SSQVCRIQINGIRCTSCCCTAEIVLQAIHGVQRIQVALETEEAEVYYDPKILNYNHLLEA
MEDIGFQTMLVSAGEDVSKIDLKVDGLGAGHSMQIIENSLQTLPGVQVIEIDPELDKVSI
SYKPSMTGPRKFIKAIESAGSENFKALVYPQGEEKESHRQDEIKQYRSTFLWSLVFTIPV
FLISMVFMYIPIINCQLDTKVVNMLNVGEVLKWMLSTPVQFIIGRRFYTGSYKALRRGSA
NMDVLIALGTNAAYFYSAYSVLRAAGSPDFEGTDFFETSSMLISIILLGKYLEVMAKGKT
SEAIAKLMDLGPETAILLTLDDYGNILSEEEIDSRLVQKNDVIKILPGAKVASDGLIIWG
ASHVNESMITGEAIPVKKGVGDPVIGGTLNENGVLHIKATRVGSDSALSHIVRLIESAQL
AKAPVQKFADTISKYFVPLVIILSFSTWLTWFLAGVFHGYPKSWIPHSMDSFQLALQFGI
SVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQALESAHKVNCVIFDKTGTLTIGK
PVVVKTTLLKSMVLQDFYELIAATEMNSEHPLAKAIVEYAKKIREDEEDPVWPEARAFES
ITGYGVKATVRNKEIIIGNKSLILDQNIAIPVDGELMLAETETMAQTGILVSIDREVTGI
LAISDPLKPSACEVISILKSMKVRSIMVTGDNWGTANSIAKEIGIETVIAEAKPEEKAEK
VKELQATGFTVAMVGDGVNDSPALAAADVGMAIGAGTDIAIEAADIVLMKSNLEDVITAI
DLSRKTFSRIRLNYIWALGYNLIGIPVAAGALFPGTGLRLPPWAAGAAMAASSVSVVLCS
LLLKNYRRPKKLENLNIHGIKIE
Download sequence
Identical sequences B9GXS9
POPTR_0003s12580.1|PACid:18217545 XP_002303665.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]