SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s12580.2|PACid:18217546 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s12580.2|PACid:18217546
Domain Number 1 Region: 596-615,659-908
Classification Level Classification E-value
Superfamily HAD-like 1.84e-55
Family Meta-cation ATPase, catalytic domain P 0.00014
Further Details:      
 
Domain Number 2 Region: 397-483
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.35e-19
Family Calcium ATPase, transduction domain A 0.0058
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000000209
Family HMA, heavy metal-associated domain 0.0011
Further Details:      
 
Domain Number 4 Region: 70-141
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000000458
Family HMA, heavy metal-associated domain 0.00095
Further Details:      
 
Domain Number 5 Region: 345-381,484-591,851-890
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000314
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 
Domain Number 6 Region: 142-210
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000017
Family HMA, heavy metal-associated domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s12580.2|PACid:18217546
Sequence length 931
Sequence
MTCSACAGSVEKAIKRLPGILEAVVDVLNNRAQVLFYPSSLVNVKTIRETIEDAGFQATL
IEDEINERSSQVCRIQINGIRCTSCCCTAEIVLQAIHGVQRIQVALETEEAEVYYDPKIL
NYNHLLEAMEDIGFQTMLVSAGEDVSKIDLKVDGLGAGHSMQIIENSLQTLPGVQVIEID
PELDKVSISYKPSMTGPRKFIKAIESAGSENFKALVYPQGEEKESHRQDEIKQYRSTFLW
SLVFTIPVFLISMVFMYIPIINCQLDTKVVNMLNVGEVLKWMLSTPVQFIIGRRFYTGSY
KALRRGSANMDVLIALGTNAAYFYSAYSVLRAAGSPDFEGTDFFETSSMLISIILLGKYL
EVMAKGKTSEAIAKLMDLGPETAILLTLDDYGNILSEEEIDSRLVQKNDVIKILPGAKVA
SDGLIIWGASHVNESMITGEAIPVKKGVGDPVIGGTLNENGVLHIKATRVGSDSALSHIV
RLIESAQLAKAPVQKFADTISKYFVPLVIILSFSTWLTWFLAGVFHGYPKSWIPHSMDSF
QLALQFGISVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQALESAHKVNCVIFDK
TGTLTIGKPVVVKTTLLKSMVLQDFYELIAATEMNSEHPLAKAIVEYAKKIREDEEDPVW
PEARAFESITGYGVKATVRNKEIIIGNKSLILDQNIAIPVDGELMLAETETMAQTGILVS
IDREVTGILAISDPLKPSACEVISILKSMKVRSIMVTGDNWGTANSIAKEIGIETVIAEA
KPEEKAEKVKELQATGFTVAMVGDGVNDSPALAAADVGMAIGAGTDIAIEAADIVLMKSN
LEDVITAIDLSRKTFSRIRLNYIWALGYNLIGIPVAAGALFPGTGLRLPPWAAGAAMAAS
SVSVVLCSLLLKNYRRPKKLENLNIHGIKIE
Download sequence
Identical sequences B9GWH2
XP_002303581.1.11743 3694.estExt_Genewise1_v1.C_LG_III2138 POPTR_0003s12580.2|PACid:18217546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]