SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s15900.1|PACid:18216593 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0003s15900.1|PACid:18216593
Domain Number - Region: 37-110,177-266
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00837
Family Calcium ATPase, transmembrane domain M 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s15900.1|PACid:18216593
Sequence length 406
Sequence
MGNHNDNNARNLRVYQTWKGSNIFCFGGRLVFGPDVRSLFLTIFLIMIPVILFCAFVSQR
LINDFQHQLGYYVVVICVILTANVIILLFLTSARDPGIIPRNLHPPEDEGSSISVDWPGS
QVAGPSLPPTKDVMVNGMVVKVKYCQTCLLYRPPRCSHCSICNNCVERFDHHCPWVGQCI
GKRNYRFFFMFVSSTTMLCLYVLAFCWVNIRKIMDTYHCNMWTAFLKSPVSGILILYTFI
CAWFVGGLTAFHLYLIFTNQTTYENFRYRYDGKMNPYNLGCIRNVLEVFFSKIPKSKNKF
RAKVRVNSSSSYASSMPLGDSLSPEVPKRSFNIEVGKRQAVADEDFEDIQSQIDSVGGLE
RCGTQPRHTNWDHKANWEITPDIHVLAAEFGMESGLANRQKISRDH
Download sequence
Identical sequences B9GYU6
XP_002303739.1.11743 POPTR_0003s15900.1|PACid:18216593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]