SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s17620.1|PACid:18218337 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s17620.1|PACid:18218337
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily SNARE-like 2.62e-29
Family Synatpobrevin N-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 125-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.61e-24
Family SNARE fusion complex 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s17620.1|PACid:18218337
Sequence length 219
Sequence
MGQQSLIYSFVARGTVILAEYTEFKGNFTGIAAQCLQKLPASNNKFTYNCDGHTFNYLVE
DGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQY
CVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQG
TKMRRKMWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC
Download sequence
Identical sequences B9H095
POPTR_0003s17620.1|PACid:18218337 3694.estExt_fgenesh4_pm.C_LG_III0602 XP_002304708.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]