SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s17820.1|PACid:18217841 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s17820.1|PACid:18217841
Domain Number 1 Region: 24-142,239-333,647-873
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-87
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 335-645
Classification Level Classification E-value
Superfamily HAD-like 1.32e-38
Family Meta-cation ATPase, catalytic domain P 0.00079
Further Details:      
 
Domain Number 3 Region: 143-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-28
Family Calcium ATPase, transduction domain A 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s17820.1|PACid:18217841
Sequence length 977
Sequence
MSADGTATAIGNGLSLQEIINENVDLERIPVEEVFQRLQCTKDGLSTEEGQKRLEIFGPN
KLEERKESKILKFLGFMWNPLSWVMEGAAVVAIVLANGQGKPPDWQDFVGIVVLLLINST
ISFVEENSAGNAAAALMAGLALKTKVLRDGRWIEHEAAVLVPGDVISIKLGDIIPADARL
LEGDPLKIDQSALTGESLPVTKKPGDEIFSGSTCKHGEIEAVVIATGVHTFFGKAAHLVD
STNQVGHFQKVLTSIGNFCIVSIVVGIIIEAIVMWPIQSRKYRDGIDNILVLLIGGIPIA
MPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEV
FANDVDQDNVILLGARASRIENQDAIDACIVGMLADPKEARASITEVHFLPFNPVEKRTA
ITYIDPDGHWHRVSKGAPEQIIALCNLREDVARKAHAIIDKYAERGLRSLAVCRQIVPEK
TKESPGGPWEFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIGKETGRRLGMG
TNMYPSSALLGQHPDESTAALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHVCGMTGD
GVNDAPALKKADIGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIY
AVTITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKE
IFATGVILGTYLALMTVVFFWIVHSSDFFSVRITTNLTTSTWFYHADKFGVRSIRNNHYE
LTSAVYLQVSIVSQALIFVTRSRSWSYVERPGIYLLIAFVLAQLIATIIAVYANWGFARI
HGIGWGWAGVIWLYSIIFYIPLDFLKFIIRYALSSKSWDNLLQNKTAFTSKEEYGKRERM
APWAADHLTIRGLHPPEGSELFNDKSNYRELHDIAEHAKRRAEVARLRELHTLKGHVESV
VKLKGLDIETIQQHYTV
Download sequence
Identical sequences B9H0B5
POPTR_0003s17820.1|PACid:18217841 XP_002304716.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]