SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s17920.1|PACid:18216917 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0003s17920.1|PACid:18216917
Domain Number - Region: 41-121
Classification Level Classification E-value
Superfamily TrmE connector domain 0.00405
Family TrmE connector domain 0.027
Further Details:      
 
Domain Number - Region: 131-200
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0575
Family SNARE fusion complex 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s17920.1|PACid:18216917
Sequence length 228
Sequence
MEVTTSSSSSWDALRKQARKLEAQLDEQMSTFRKLASSKGSTKVDFPENDLESGIDRLLK
QLQQVNSQMQAWVSSGGSEMVSHTLTRHQEILQDLTQEFHRLRSGMRAKQEHALLLEDFR
EFDRTRLDLEDGVGSADQALLREHASISRNTGQMDNVISQAQSTLGALVLQRSTFGGINS
KLSNVSSRLPTVNQILSAIKRKKSMDAIILSLVASVCTFLIFIYWLTK
Download sequence
Identical sequences B9GVJ3
POPTR_0003s17920.1|PACid:18216917 XP_002303840.1.11743 3694.eugene3.00031501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]