SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s05020.1|PACid:18224474 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s05020.1|PACid:18224474
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily t-snare proteins 1.65e-29
Family t-snare proteins 0.00062
Further Details:      
 
Domain Number 2 Region: 152-216
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000174
Family SNARE fusion complex 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s05020.1|PACid:18224474
Sequence length 246
Sequence
MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISSDSGEQVRLTKELLAACESIEWQVDEL
DKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKKAVVAGKELNLSGTASVNGMR
RELMRMPDAQQTDKSNQYTQDNDDFIQSESDRQMLLIKQQDDELDELSASVERIGGVGLT
IHEELLAQERIIGDLDTEMDTTSNRLDFVQKKVAMVMKKASAKGQLMMILFLVVLFIILF
VLVFLT
Download sequence
Identical sequences B9H2P0
XP_002305773.2.11743 POPTR_0004s05020.1|PACid:18224474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]