SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s11470.1|PACid:18224637 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s11470.1|PACid:18224637
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily t-snare proteins 1.49e-26
Family t-snare proteins 0.00057
Further Details:      
 
Domain Number 2 Region: 132-188
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.35e-16
Family SNARE fusion complex 0.0025
Further Details:      
 
Weak hits

Sequence:  POPTR_0004s11470.1|PACid:18224637
Domain Number - Region: 180-217
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0248
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s11470.1|PACid:18224637
Sequence length 220
Sequence
MTDIFEGYERQYCELSSNLSRKCTAALSLDGEKKKQKISEVKAGLEDAEALIRKMDLEAR
NLQPNVKAVLLAKLREYKSDLNNLKTEVKRIGSGNLNAAARDELLEAGMTDALMASGDQR
SRLMMATERLYHSSDRIKDSRRTMLETEELGVSILQDLHQQRQSLLHAHNTLHGVDDNIG
KSKRVLTAISRRMNRNKWMISAIIAVLVVAVILILYFKLK
Download sequence
Identical sequences A9P918
3694.estExt_fgenesh4_pm.C_LG_IV0412 POPTR_0004s11470.1|PACid:18224637 POPTR_0004s11470.2|PACid:18224638 XP_002306052.1.11743 XP_006384291.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]