SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s14450.1|PACid:18226266 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s14450.1|PACid:18226266
Domain Number 1 Region: 157-254,389-483,949-1165
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.24e-45
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 2 Region: 484-500,626-715,783-837
Classification Level Classification E-value
Superfamily HAD-like 6.55e-29
Family Meta-cation ATPase, catalytic domain P 0.013
Further Details:      
 
Domain Number 3 Region: 495-680
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.13e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0062
Further Details:      
 
Domain Number 4 Region: 256-388
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.22e-16
Family Calcium ATPase, transduction domain A 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s14450.1|PACid:18226266
Sequence length 1188
Sequence
MVLRFNVGGKVVERVDLIRKKKWPWRLDIFPFAILYAIWMVTVVPSIDIVDAFIVLGGLV
AIHVLVLLFTAWSVDFKCFVQYSKVNDIRAADTCKVTPAKFSGSKEVVPLYIRQQSATSS
SPGDGEEIYFDFRKQWFIYSKENETFCKLPYPTKETFGHYLKSTGHGSEAKVAAATEKWG
RNVFEYPQPTFQKLLKEQCMEPFFVFQVFCVGLWCLDEYWYYSLFTLFMLFMFESTMAKS
RLKTLSELRRVRVDTQTIMVHRCGKWVKLSGTDLLPGDVVSIGRSSGQHGEDKSVPADML
LLAGSAILNEAILTGESTPQWKVSITGRGMEEKLSAKRDKNHVLFGGTKILQHTPDKNFP
LRAPDGGCLAVVLRTGFETSQGKLMRTILFSTERVTANSWESGLFILFLVVFAVIAAGYV
LKKGLEDPTRSKYKLFLSCSLIITSVIPPELPMELSIAVNTSLIALARRGIFCTEPFRIP
FAGKVDICCFDKTGTLTSDDMEFRGVVGLTESADLESDMTKVPVRTAEILASCHALVFVD
NKLVGDPLEKAALTGIDWSYKSDEKAMPKKGGGNAVQIVQRHHFASHLKRMAVVVRTQEE
FLAFVKGAPETIQDRLIDLPPSYVDTYKKYTRQGSRVLALAFKYLPDMTVSEARSLDRDV
VETGLAFAGFAVFNCPIREDSASVLSELKNSSHDLVMITGDQALTACHVASQVHIISKPA
LILGPSRSGEGYEWISPDEMEKISYGDKGAEELSETHDLCIGGDCIDMLQQSSAVLQVIP
YVKVFARVAPEQKELILTTFKTVGRVTLMCGDGTNDVGALKQAHVGVALLNAVPPTKSGN
SSSETPKDGNLKPSKSKKSKPEVSNLNGESSSRAKAVTKSDSSSQTAGNRHQTAAEMQRQ
RLKKLMEEMNEEGDGRSAPIVKLGDASMASPFTAKHASVAPTTDIIRQGRSTLVTTLQMF
KILGLNCLATAYVLSVMYLDGVKLGDVQATISGVFTAAFFLFISQARPLPTLSAERPHPH
VFCFYVFLSLMGQFAIHLFFLMSSVKSAEKYMPDECIEPDSDFHPNLVNTVSYMVSMMLQ
LATFAVNYIGHPFNQSITESKPFLYAILAAAGFFTVITSDLFRNLNDWLKLVPLPPELRN
KLLIWALLMFLSCYTWEKLLRWAFPGRIPSWKKRQRLAAANLEKKKRV
Download sequence
Identical sequences U5GIQ5
XP_006384374.1.11743 POPTR_0004s14450.1|PACid:18226266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]