SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s14450.2|PACid:18226267 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s14450.2|PACid:18226267
Domain Number 1 Region: 175-255,721-937
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.05e-35
Family Calcium ATPase, transmembrane domain M 0.038
Further Details:      
 
Domain Number 2 Region: 256-272,398-487,555-609
Classification Level Classification E-value
Superfamily HAD-like 4.06e-29
Family Meta-cation ATPase, catalytic domain P 0.013
Further Details:      
 
Domain Number 3 Region: 267-452
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.26e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0062
Further Details:      
 
Domain Number 4 Region: 28-160
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-16
Family Calcium ATPase, transduction domain A 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s14450.2|PACid:18226267
Sequence length 960
Sequence
MLFMFESTMAKSRLKTLSELRRVRVDTQTIMVHRCGKWVKLSGTDLLPGDVVSIGRSSGQ
HGEDKSVPADMLLLAGSAILNEAILTGESTPQWKVSITGRGMEEKLSAKRDKNHVLFGGT
KILQHTPDKNFPLRAPDGGCLAVVLRTGFETSQGKLMRTILFSTERVTANSWESGLFILF
LVVFAVIAAGYVLKKGLEDPTRSKYKLFLSCSLIITSVIPPELPMELSIAVNTSLIALAR
RGIFCTEPFRIPFAGKVDICCFDKTGTLTSDDMEFRGVVGLTESADLESDMTKVPVRTAE
ILASCHALVFVDNKLVGDPLEKAALTGIDWSYKSDEKAMPKKGGGNAVQIVQRHHFASHL
KRMAVVVRTQEEFLAFVKGAPETIQDRLIDLPPSYVDTYKKYTRQGSRVLALAFKYLPDM
TVSEARSLDRDVVETGLAFAGFAVFNCPIREDSASVLSELKNSSHDLVMITGDQALTACH
VASQVHIISKPALILGPSRSGEGYEWISPDEMEKISYGDKGAEELSETHDLCIGGDCIDM
LQQSSAVLQVIPYVKVFARVAPEQKELILTTFKTVGRVTLMCGDGTNDVGALKQAHVGVA
LLNAVPPTKSGNSSSETPKDGNLKPSKSKKSKPEVSNLNGESSSRAKAVTKSDSSSQTAG
NRHQTAAEMQRQRLKKLMEEMNEEGDGRSAPIVKLGDASMASPFTAKHASVAPTTDIIRQ
GRSTLVTTLQMFKILGLNCLATAYVLSVMYLDGVKLGDVQATISGVFTAAFFLFISQARP
LPTLSAERPHPHVFCFYVFLSLMGQFAIHLFFLMSSVKSAEKYMPDECIEPDSDFHPNLV
NTVSYMVSMMLQLATFAVNYIGHPFNQSITESKPFLYAILAAAGFFTVITSDLFRNLNDW
LKLVPLPPELRNKLLIWALLMFLSCYTWEKLLRWAFPGRIPSWKKRQRLAAANLEKKKRV
Download sequence
Identical sequences U5GFD8
XP_006384373.1.11743 POPTR_0004s14450.2|PACid:18226267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]