SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s17690.1|PACid:18226095 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s17690.1|PACid:18226095
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Cupredoxins 2.59e-18
Family Plastocyanin/azurin-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s17690.1|PACid:18226095
Sequence length 112
Sequence
MGDVDYHDWAANKKFHVACFPPQDHNYRFHDVKQVTRQDFKSCNVASPIASYYNHHGYDS
LTLNRLGHFYFISAFPDHCQAGQKIDILVTPETSSPTPPPLSSPISAASATS
Download sequence
Identical sequences U5GLZ4
XP_006384560.1.11743 POPTR_0004s17690.1|PACid:18226095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]