SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s05420.1|PACid:18206394 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s05420.1|PACid:18206394
Domain Number 1 Region: 81-170,271-389,748-955
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.48e-109
Family Calcium ATPase, transmembrane domain M 0.00074
Further Details:      
 
Domain Number 2 Region: 393-413,546-803
Classification Level Classification E-value
Superfamily HAD-like 2.33e-57
Family Meta-cation ATPase, catalytic domain P 0.00035
Further Details:      
 
Domain Number 3 Region: 401-603
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.7e-41
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0042
Further Details:      
 
Domain Number 4 Region: 170-270
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.54e-26
Family Calcium ATPase, transduction domain A 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s05420.1|PACid:18206394
Sequence length 966
Sequence
MAYTAIYFTRLLGSLSKTALESQTKILRSLSYVALDVRDDTPRENLVSLINVDQRTLADM
VKGKNLESLKQLGGVTQVATTILETDVKNGAKEAGVAHRRDVFGANRFKKPPAKSFLSFV
VEAFKDMTIIILLVCAIMSLGFGIKQHGLKEGCNFKQSKQFEKLSDESNNINVQVVRDGR
HHHLSIFDVVVGDVVSLKIGDQIPADGMFLNGYSLKVDESSMTGESDHVEVNGKNNPFLL
SGTKVTDGFGFMVVTSVGMNTAWGEMMSLICHDLDEQTPLQARLNKLTSSIGKVGLTVAV
LVLAVLMIRYFTGNTRDDNGRKEYIGSQTKFSDVLDSVVGIIAVAVTIVVVAIPEGLPLA
VTLTLAYSMKRMMKDNAMVRKLSACETMGSATIICTDKTGTLTLNQMKVTEFWPGNETID
DDYLTEIESEVYQLLQEGVALNTTGTVNKSHATLVPEITGSPTEKAILSWALLDLGMNIN
ETKEECEIIHVETFNSEKKRSGVLMRKNNEKTIHTHWKGAAEMILAMCSNYYVRNGELKS
LNEEEKVELGAIIQSMASKSLRCIAFAHKKVAEDNGQASEKLQESGLSLLGFVGLKDPCR
PGVRTAVESCKNAGVNVKMITGDNVHTARAIAIECGILSPEQDMENGAVVEGVQFRNYSP
EERMAMIDNIQVMARSSPFDKLLMVQCLKEKGHVVAVTGDGTNDAPALKEADIGLSMGIQ
GTEVAKESSDIVILDDNFSSVVTVLRWGRCVYNNIQKFIQFQLTVNVAALAINFVAAISS
GKVPLTAVQLLWVNLIMDTLGALALATEQPTIDLMARTPVGRSEPLITKIMWRNLVAQAL
YQVSILLTLQFKGKAIFGVDEKIKNTLVFNTFVLCQVFNEFNARKLEKKNIFKGIHKNKL
FLAIIGVTIILQVIMVELLKKFASTERLNWEQWGACIGIAVLSWPIGCLVKCIPVSSKQL
MDPKNI
Download sequence
Identical sequences B9MZE4
POPTR_0005s05420.1|PACid:18206394 XP_006382786.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]