SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s17550.1|PACid:18207465 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s17550.1|PACid:18207465
Domain Number 1 Region: 34-102
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000206
Family SNARE fusion complex 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s17550.1|PACid:18207465
Sequence length 135
Sequence
MASRSSGGGGSIYGGAAPYRSREGLSTRPMASSDEIQLRIDPIHGDLDDEITGLRSQVRQ
LRNVAQEIESEAKYQKDFLETLQMTVMKAQAGVKNNIRKLNKSIIKNGGNHIVHVVLFAL
FCFMVVYLWSKMSRR
Download sequence
Identical sequences B9H6Y2
POPTR_0005s17550.1|PACid:18207465 XP_002306555.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]