SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s19070.1|PACid:18207035 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s19070.1|PACid:18207035
Domain Number 1 Region: 52-145,245-344
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 8.76e-34
Family Calcium ATPase, transmembrane domain M 0.006
Further Details:      
 
Domain Number 2 Region: 507-631
Classification Level Classification E-value
Superfamily HAD-like 8.05e-31
Family Meta-cation ATPase, catalytic domain P 0.00069
Further Details:      
 
Domain Number 3 Region: 365-519
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.96e-30
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0093
Further Details:      
 
Domain Number 4 Region: 147-242
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.18e-23
Family Calcium ATPase, transduction domain A 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s19070.1|PACid:18207035
Sequence length 634
Sequence
MECFQVSPQATIPHLHKSRLQVLTICADELGSIVEGHDEKKLKFYGGCDLLNHRQETYGI
NKFAASQVRSFWIFVWEALQDMTLMILGVCAFVSLIVGIATEGWPNGAHDGLGIVASILS
VVFVTAVSDYRQSLQFRDLDKEKRKITIQVTSNGFRQKLSIYDLLPGDIVHLAIGDQVPA
DGLFVSGFSVLIDESSLTGESEPVMVNSENPCMLSGTEVQDGSCKMMVATVGMRTQCDKL
MATLSEGGDDETPLQVKLNGVAIIIGKIGLFFAVVSFAVLIQGLFSRKWQAGTYLSWSGD
DALEMLEYSAIAVTIVVVHLAFSMKKMMNDKALVRHLAACETMGSATNICIDLPTKASSL
FSEIPASSGKLLLQTLFNNTGGEVIVNKYGKCEILGPPTETSLLEFGLSLGGDFQAERQA
VKLVRVEPFNSTKNQTGVVVELPEGGLRAHTKDASEIVLAACNKVINSNGDVIPLDEESI
NNLKATIDQFASEALRTLCLAYMVLERIAGIKDPVRPGVKESVAVCRSVGIPVRMFTGDN
INTAKAIARECGILTDDGIAVEGPDFREKSQEELLQLIPKIQVMARSSPLDKHTLVKHLC
TFGEVVAVTGDGTNDAPSLHEADIGLAMGIAGTE
Download sequence
Identical sequences U5GGF6
POPTR_0005s19070.1|PACid:18207035 XP_006383552.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]