SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s23710.1|PACid:18206181 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s23710.1|PACid:18206181
Domain Number 1 Region: 85-205,306-424,788-995
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.32e-122
Family Calcium ATPase, transmembrane domain M 0.00083
Further Details:      
 
Domain Number 2 Region: 428-448,581-843
Classification Level Classification E-value
Superfamily HAD-like 3.02e-56
Family Meta-cation ATPase, catalytic domain P 0.00041
Further Details:      
 
Domain Number 3 Region: 437-635
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.45e-35
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0069
Further Details:      
 
Domain Number 4 Region: 205-304
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.09e-25
Family Calcium ATPase, transduction domain A 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s23710.1|PACid:18206181
Sequence length 1033
Sequence
MASSKPSHIDCSTLLVNTFKKAQKRWRIAYLTIRSVRAMLSLVREIVSETNSHQKGNEST
INIPNIDQTKLTEMVKEKDLIALNHLGGVEGVATVLGTNSKIGITGHDQEVSRRREMFGS
NTYHKPPPKGFLFFVMEAFRDTTILILLVCAALSLGFGIKQHGIKEGWYEGGSIFVAVFL
VIVVSAFSNYRQETQFDKLSKISNNIKVDVLRNERRQQISIFDIVVGDVVFLKIGDQIPA
DGLFLDGHSLEVDESSMTGESDHVAANTKENPFLFSGSKIADGYARMLVTSVGMNTAWGE
MMSSINRDSDERTPLQARLDKLTSSIGKVGLSVAFIVLVVMLVRYFTGNTKDGNGKKEYI
GSKTNTDDVLNAVVRIVAAAVTIVVVAIPEGLPLAVTLTLAYSMKRMMADQAMVRKLSAC
ETMGSATVICTDKTGTLTLNQMKVAKFWLGQEPIEEDTYKAIAPSILELLHQGVSLNTTG
SVYKSASGSGPEFSGSPTEKAILSWAVSELGMDMEELKQSCTILHVETFNSEKKRSGVSI
RKMADDTVHVHWKGAAEMILALCSSYYESSGIIKSMDEDERSKIGKIIQGMAASSLRCIA
FAHKRVTEEGMKDDDGESHQRLQEDGLTFLGLVGLKDPCRIGAKKAVELCKAAGVSVKMI
TGDNIFTAKAIATECGILELNNYVDNEEVVEGVVFRNYTNEQRMEKVDKIRVMARSSPFD
KLLMVQCLRQKGHVVAVTGDGTNDAPALKEADIGLSMGIQGTEVAKESSDIVILDDNFTS
VATVLRWGRCVYNNIQKFIQFQLTVNVAALVINFIAAVSAGEVPLTAVQLLWVNLIMDTL
GALALATERPTDELMEMTPVGRTEPLITNIMWRNLLAQAFYQIAILLTLQFAGESIFNVS
AEVNDTLIFNTFVLCQVFNEFNARSMEKQNVFKGIHRNHLFLGIIAITIVLQVVMVEFLK
KFASTERLNWWQWVTCIVIAAVSWPIGWFVKLIPVSGKPLFIHESSFARFTPLKIHWDMN
VAEKDSFIEISLE
Download sequence
Identical sequences B9H8E2
POPTR_0005s23710.1|PACid:18206181 XP_002307612.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]