SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s24300.1|PACid:18207865 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s24300.1|PACid:18207865
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000767
Family SNARE fusion complex 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s24300.1|PACid:18207865
Sequence length 123
Sequence
MNSRRDIRNNRAALFDGIEEGGIRASSSYSSHEIDEQDNERALEGLQDRVILLKRLSGDI
NEEVDNHNLMLDRMGNDMDSSRGVLSGTMDRFKMVFETKSSRRMFTLVASFVVLFLIIYY
LTR
Download sequence
Identical sequences A0A1X9ITT4 B9H8J7
POPTR_0005s24300.1|PACid:18207865 3694.eugene3.00051282 XP_002307637.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]