SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s00770.1|PACid:18213685 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s00770.1|PACid:18213685
Domain Number 1 Region: 9-127,224-318,632-841
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.88e-89
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 320-381,413-630
Classification Level Classification E-value
Superfamily HAD-like 7.35e-39
Family Meta-cation ATPase, catalytic domain P 0.00069
Further Details:      
 
Domain Number 3 Region: 127-224
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.35e-27
Family Calcium ATPase, transduction domain A 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s00770.1|PACid:18213685
Sequence length 944
Sequence
MEDIKNESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLG
FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAS
LMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSALTG
ESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI
GNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKDTLILHAA
RASRTENQDAIDASIVGMLGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNGDWYRSSK
GAPEQIIELCELKGNIRKKAHEIINNFADRGLRSLGVARHRIPEKNKESAGAPWEFVGLL
PLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDNKD
ESIASVPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGI
AVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLV
ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYLAII
TVLFFWLAHGTDFFSDKFGVRSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFTERP
GLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFITRY
ALTGKAWDNLLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQSPETMKNDKASYRELSE
LAEQAKRRAEVARLREIHTLKGHVESVVKMKGLDIETIQQHYTV
Download sequence
Identical sequences B9HCD3
3694.fgenesh4_pm.C_LG_VI000025 XP_002307856.1.11743 POPTR_0006s00770.1|PACid:18213685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]