SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s03120.1|PACid:18212546 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s03120.1|PACid:18212546
Domain Number 1 Region: 131-188
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000776
Family SNARE fusion complex 0.0036
Further Details:      
 
Weak hits

Sequence:  POPTR_0006s03120.1|PACid:18212546
Domain Number - Region: 40-121
Classification Level Classification E-value
Superfamily GAT-like domain 0.0196
Family GAT domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s03120.1|PACid:18212546
Sequence length 221
Sequence
MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL
QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAANRENLLGPDKKTDDD
VVNRASGLDNHEQDEGLEKLEETVTSTKHIALAVNEELTLHTKLLDDLDEHVDVTNSRLQ
TVQRKLALLNKRTKGGCSCLILLVIAIVILIVVIRGLFKYL
Download sequence
Identical sequences B9HDU2
POPTR_0006s03120.1|PACid:18212546 XP_002307951.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]