SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s03130.1|PACid:18211660 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s03130.1|PACid:18211660
Domain Number 1 Region: 86-124
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000314
Family SNARE fusion complex 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s03130.1|PACid:18211660
Sequence length 164
Sequence
MASPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPETQRQFSAARRKATILRTKLDIL
QSLLSALPSKQPLERDESASRNAEKFEYKKQDEGLEKLEETVISTKHIALAVNEELTLHT
RLLRVQKNLAILNKRTKGGCACWVFLVIAIVILIVVVWLLIKYL
Download sequence
Identical sequences U5G5R5
XP_006380963.1.11743 POPTR_0006s03130.1|PACid:18211660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]