SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s04510.1|PACid:18213554 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s04510.1|PACid:18213554
Domain Number 1 Region: 102-218,318-429,786-997
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.31e-117
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 434-453,590-841
Classification Level Classification E-value
Superfamily HAD-like 9.41e-54
Family Meta-cation ATPase, catalytic domain P 0.00055
Further Details:      
 
Domain Number 3 Region: 441-645
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.36e-44
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0062
Further Details:      
 
Domain Number 4 Region: 221-316
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-26
Family Calcium ATPase, transduction domain A 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s04510.1|PACid:18213554
Sequence length 1018
Sequence
MSFIRREFITHLEDGFWVHWKYCMYHNHEIKLAALSIAKMEKIRIALYVKRAALQFLDAG
NASGQSEYKISDEVKEAGFDIDPDELASIVREHGMKGLKKNGGVDGIAEKVSVSFEEGVR
TSDVSTRQKIYGCNRYTEKPPRSFLMFVWEAMQDLTLIILMICALVSIGVGIATEGWPKG
MYDGLGIILSVFLVVMVTAASDYNQSLQFRDLDREKKKISIQVTRDGRKQEISIYDLVVG
DVVQLSIGDIVPADGIYISGYSLVIDESSLSGESEPVNVYENKPLLLSGTKVQDGSGKMI
VTAVGMRTEWGKLMETLSEGGEDETPLQVKLNGVATVIGKIGLAFAVLTFLVLTVRFLVE
KALRHEFTDWSSSDAMTLLNYFAIAVTIIVVAVPEGLPLAVTLSLAFAMKKLMNEKALVR
HLSACETMGSATCICTDKTGTLTTNCMVVDKIWIRGKTEVIKSRHSEGILEMGISEGVLN
LLFQVIFQNTACETSKDENGKNKILGTPTEKALFEFGLLLGGDFDAQRKDFQIMKVEPFN
SVRKKMSVLVALPSGELRAFCKGASEIVLKMCDKFLDDSGKSVPLFEEQILSISDVINGF
ASEALRTLCLAFKDLDDPAYEGSIPDFGYTLVTVVGIKDPVRPGVKDAVQTCLAAGITVR
MVTGDNINTAKAIAKECGILTEGGLAIEGPEFRIMNPQQMRENIPKIQVMARSLPLDKHT
LVTNLRNMFKEVVAVTGDGTNDAPALHEADIGLSMGIAGTEVAKESADVIIMDDNFRTIL
NVAKWGRAVYINIQKFVQFQLTVNVVALVINFASACITGSAPLTAVQLLWVNMIMDTLGA
LALATEPPNDGLMKRAPVGRGASFITKTMWRNIFGQSIYQLVILAVLQFDGKRLLGLSGT
DATTMLNTVIFNTFVFCQVFNEINSRDIEKINVFRGMFSSWIFTGVMVITVVFQVIIVEF
LGTLASTVPLSWQMWLFCVLIGAVSMPVAVVLKCIPVERGNPKQHDGYDALPPGPDQA
Download sequence
Identical sequences B9H9I2
POPTR_0006s04510.1|PACid:18213554 XP_002308011.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]