SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s07240.1|PACid:18212335 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s07240.1|PACid:18212335
Domain Number 1 Region: 144-263,363-481,845-1060
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.84e-121
Family Calcium ATPase, transmembrane domain M 0.00085
Further Details:      
 
Domain Number 2 Region: 485-505,637-900
Classification Level Classification E-value
Superfamily HAD-like 1.19e-56
Family Meta-cation ATPase, catalytic domain P 0.00026
Further Details:      
 
Domain Number 3 Region: 494-692
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.73e-37
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0056
Further Details:      
 
Domain Number 4 Region: 265-360
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.89e-25
Family Calcium ATPase, transduction domain A 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s07240.1|PACid:18212335
Sequence length 1082
Sequence
MTSLFKSSPYRRRRDDLEAGESRSTGFDVDDGDSSDPFDIPSTKNASIGRLRRWRQAALV
LNASRRFRYTLDLKKEEEKQQILRKIRAHAQAIRAAYLFKEAGKRVNGTAELHILPPPVG
DFGISQDQLSTITRDHNHNALEEIGGVKGVADALKTNTEKGIYGDVADLLKRKNAFGSNT
YPQKKGRSFWMFLWEAWQDLTLIILMIAAVASLVLGIKTEGIKEGWYDGASIAFAVILVI
VVTAISDYKQSLQFQNLNEEKRNIHLEVIRGGRRIEVSIYDIVVGDVIPLNIGDQVPADG
ILITGHSLAIDESSMTGESKIVHKNSREPFLMSGCKVADGSGTMLVTGVGINTEWGLLMA
SISEDTGEETPLQVRLNGVATFIGIVGLTVALLVLIVLLVRYFTGHTKNFDGSPQFKAGK
TKASTAVDGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYSMRKMMRDKALVRRLSACETM
GSATTICSDKTGTLTLNQMTIVEAYSGGQKIDPPDSKSQLPPILSSLLMEGIAQNTTGSV
FVPEGGGDPEISGSPTEKAILGWAVKLGMNFDAVRSESSIIHVFPFNSEKKKGGVALQLP
DSQVHIHWKGAAEIVLASCTEYINASGKIVPLDQDKVLFFKKSIEDMAASSLRCVAIAYR
TYDMDKVPADEQQKTQWELPQDDLVLLAIVGIKDPCRPGVRDAVQLCKNAGVKVRMVTGD
NPQTAKAIALECGILSSAEDAVEPNVIEGRVFRNYSDAERVEIAEKISVMGRSSPNDKLL
FVQALKKRGHVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIIILDDNFASVVK
VVRWGRSVYANIQKFIQFQLTVNVAALIINVVAAISSGDVPLNAVQLLWVNLIMDTLGAL
ALATEPPTDHLMHRPPVGRREPLITNIMWRNLLIQAAYQVSVLLVLNFRGKSLLGLEHET
PQRANKVKNTLIFNAFVLCQIFNEFNARKPDELNIFKGITKNHLFVVIVGITLVLQVIII
EFVGKFTSTVKLNWKQWLISAVIAIISWPLAAIGKLIPVPRTPLHKFFTKMFHRSGNSPS
DR
Download sequence
Identical sequences B9HAW9
XP_002309001.2.11743 POPTR_0006s07240.1|PACid:18212335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]