SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s07650.2|PACid:18212261 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s07650.2|PACid:18212261
Domain Number 1 Region: 398-417,459-699
Classification Level Classification E-value
Superfamily HAD-like 1.56e-46
Family Meta-cation ATPase, catalytic domain P 0.00082
Further Details:      
 
Domain Number 2 Region: 213-298
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.75e-21
Family Calcium ATPase, transduction domain A 0.0067
Further Details:      
 
Domain Number 3 Region: 149-204,299-393,648-685
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.54e-19
Family Calcium ATPase, transmembrane domain M 0.009
Further Details:      
 
Domain Number 4 Region: 14-86
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000353
Family HMA, heavy metal-associated domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s07650.2|PACid:18212261
Sequence length 1168
Sequence
MAAELEKSNKAATKKLQKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVF
HDDLLISQLQIVKALNQARLEANVRAYGETKHQKKWPSPYAMACGVLLLLSLLKYVYHPL
RWFAIGAVAVGILPICLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIA
EWLESRASHKASAVMSSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVV
VDGNCEVDEKTLTGESFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEE
AQNSKSKTQRFIDKFAQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCA
LILSTPVATFCALTKAASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLC
NDISVDTLLYWVSSIESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEG
KDIYIGNRKIAHRASGTVPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKE
LKSLGIKTAMLTGDSEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGD
GLNDAPALATADIGISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVI
MSMTTKSAILALAFAGHPLVWAAVLADVGTCLLVILNSMLLLRGTHAGKCSKSSGASHSH
KHGTKNSSHNHSSHNHRNCCSSQNVKKVECGAQKCCSSPKVEQVQSGALNSTCASRCCSS
PKVEKGPSGSQNSSCTSGVCSSPKVEKVHSGAQNSSCASGCCSSQKVEKVQLAAQNSNCA
SGWCCSRPKVEKVQSEDQNSNCASRCCSSQKAEVKLVAQNPSCDSGCCSRPKVEKVQSED
QNSNCASRCCSSQKVVKEHCVAQSSSLASGCQSSQHSISSCRNQECADSAKSHDARVATN
ASGVHEAKHHDHSCFNTVNPNTEANHPRSHDCSSPPKLKHLCHNSVETQGKCSDGDGLHK
EKHCHRSHGEPAATHHGIHHHSSHSSHDLEGSQKTTDNTTNCCSKSSCKNTIDIPKNEES
LGEIVESSCSPQHQHQELHQELKKCCTGCAPPHTVIEIEPTTMHACMSMEKREIGGCCQS
YMKECCSKHGHFATGFGGGLSEITIEQV
Download sequence
Identical sequences U5G9M1
POPTR_0006s07650.2|PACid:18212261 XP_006381162.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]