SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s13150.1|PACid:18211342 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s13150.1|PACid:18211342
Domain Number 1 Region: 163-230
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000785
Family SNARE fusion complex 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s13150.1|PACid:18211342
Sequence length 265
Sequence
MSVIDILTRVDAICNKYDKYDVEKQKDLNVSGDDAFARLYAAVDADIEAALQKAELASKE
KSKASAVAINAELRRTKARLLEEVPKLQRLAIKKVKGLSIEELAARNDLVHALPDRIQAI
PDGSSAALKQTGGWGSSAPRTEIKFDSDGQFDNEYFQESETSSQFRQEYEMRKMKQDQGL
SMISEGLDTLKNMAHDMNEELDRQVPLMDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSR
NFCIDIVLLIIILGIAAYLYNVLKK
Download sequence
Identical sequences U5GAJ4
XP_006381472.1.11743 POPTR_0006s13150.1|PACid:18211342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]