SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s17960.1|PACid:18211808 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s17960.1|PACid:18211808
Domain Number 1 Region: 1-66,163-257,571-781
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.88e-71
Family Calcium ATPase, transmembrane domain M 0.0064
Further Details:      
 
Domain Number 2 Region: 259-569
Classification Level Classification E-value
Superfamily HAD-like 1.83e-39
Family Meta-cation ATPase, catalytic domain P 0.00076
Further Details:      
 
Domain Number 3 Region: 66-163
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.93e-30
Family Calcium ATPase, transduction domain A 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s17960.1|PACid:18211808
Sequence length 885
Sequence
MWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGITCLLVINSTISFIEENNAGNAAAAL
MAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGE
SLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIG
NFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKL
SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFAKGVDKDYVILLAAR
ASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAAGNWHRASKG
APEQILALCNCREDVKKKVHSCIDKFAERGLRSLAVARQQVPEKSKESPGGPWEFVGLLN
LFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDA
SIATLPVEELIERADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIA
VADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIA
LIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMT
VIFFWAVHDTDFFSEKFGVRSLRKNDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPG
LLLVSAFMIAQLVATVIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYI
LSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETAGVFNEKSGYRELS
EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV
Download sequence
Identical sequences U5GBH3
POPTR_0006s17960.1|PACid:18211808 XP_006381782.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]