SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s20190.1|PACid:18210993 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s20190.1|PACid:18210993
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SNARE-like 5.49e-44
Family Synatpobrevin N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 133-197
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.92e-20
Family SNARE fusion complex 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s20190.1|PACid:18210993
Sequence length 199
Sequence
MKITALLVLKCNPEGSDPVILANAMDVSHFGYFQRSSVKEFIFFVGRTVAKRTPPGQRQS
VQHEEYKVHTYNRNGLCALGFMDDHYPVRSAFSLLNQVIDEYQKNFGESWRAAQADSTQP
WPYLNEALTKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSA
ASQMFYKQAKKTNQCCTIL
Download sequence
Identical sequences B9HAR1
XP_002309328.1.11743 XP_011033466.1.28252 POPTR_0006s20190.1|PACid:18210993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]