SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s20290.1|PACid:18212132 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s20290.1|PACid:18212132
Domain Number 1 Region: 14-132,229-323,637-846
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-88
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 325-381,418-635
Classification Level Classification E-value
Superfamily HAD-like 4.62e-39
Family Meta-cation ATPase, catalytic domain P 0.00071
Further Details:      
 
Domain Number 3 Region: 132-229
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.59e-28
Family Calcium ATPase, transduction domain A 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s20290.1|PACid:18212132
Sequence length 949
Sequence
MGDVSLEQIKNENIDLERIPVEEVFQQLRCTKEGLSTAQGEERLKIFGPNKLEEKRESKF
LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAG
NAAAALMAGLAPKTKVLRDGKWMEEDASILVPGDMISIKLGDIVPADARLMKGDPLKIDQ
SALTGESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQK
VLTAIGNFCICSIAIGMLVEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMA
IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDMDKDTL
LLLAARASRIENQDAIDASIVGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNGDW
HRSSKGAPEQIIELCNVKGETKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAPWE
FVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL
GNSKDESISGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK
ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVL
GFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGT
YMAIMTVLFFWLAHDTDFFPEKFGVRTIRGKPDELTAALYLQVSIISQALIFVTRSRSWS
FVECPGLLLVSAFIAAQLVATLIAVYASWSFARIEGIGWGWAGIIWLFSIITYIPLDIIK
FIIRYALTGKAWDNMLQNKTAFTNKKDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTY
RELSELAEQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV
Download sequence
Identical sequences B9HAQ1
3694.fgenesh4_pg.C_LG_VI001183 POPTR_0006s20290.1|PACid:18212132 XP_002309321.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]