SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s23690.1|PACid:18213753 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s23690.1|PACid:18213753
Domain Number 1 Region: 473-766
Classification Level Classification E-value
Superfamily HAD-like 2.47e-32
Family Meta-cation ATPase, catalytic domain P 0.004
Further Details:      
 
Domain Number 2 Region: 241-274,358-468,709-739
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000497
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 
Domain Number 3 Region: 297-357
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000418
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s23690.1|PACid:18213753
Sequence length 774
Sequence
LATLNGRVALRPRAIPNFTLSSSLQTETNLQNAAFQAPNKKNNSAILLDVTGIMCGAYER
VESAVVNMLTETAAVKLKPEALLEGEMSGSVAESLAKRLSECGFEAKKRVSGSGVAENVK
MWKDMIKKKELIVKSRNSVLFAWTLVAVCCGSHASHILHSLGIHAGHDDVLHSSYVKGGL
ALGALLGPGRDLLVDGLRAFKKGSPNMNSLVGFGSVAFIISVISLLSPELEWDASFFDVQ
VMLLGFVLLGRSLEEKARIRASSDMNELLSLMSTQSRLVISSSDSNSPTDTVLRSAAIYT
EVPTDDVRVGVTGSVLAGRSIVDESMLTGESLPDGPLRIEALSVGSNSTISSIICMVEDA
QGNEAPIQRLADSIAGPFVYSVMTISAVTFSFWYYTGSHFFPDVLLNDIAGPDGDPLLLS
LKLSVDVLIVSCPCALGLATPTAILVGTLLRAKQGLLIRGGDVLERLASINYVALDKTGT
LTEGKPAVSAVSSISYKDSEILQMAAAVEKTALHPIARAIVNKAESLKLTIPVTRGQLTE
PGFGTLAEVDGSLVAVGSLDWVQERFQRRTSMSDLKDLETEVMYQSSEGMSSSSYSKTVV
YVGREGEGIIGAIAISDGLCHDAESTVINEFINASLNPRQKYKAITSLQAAGHRVAMVGD
GINDAPSLALADVGIAIQNEAQENAASDVASIVLLGNRLSQVVDALDLSRATMAKVYQNL
SWAIAYNVVAIPIAAGVLLPQYDFAMAPSLSGGLMALSSVFVVTNSLPLQLHKS
Download sequence
Identical sequences B9HD02
POPTR_0006s23690.1|PACid:18213753 XP_002309463.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]