SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s24020.1|PACid:18211172 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s24020.1|PACid:18211172
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-38
Family Ankyrin repeat 0.00025
Further Details:      
 
Weak hits

Sequence:  POPTR_0006s24020.1|PACid:18211172
Domain Number - Region: 301-316,344-438
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0144
Family Calcium ATPase, transmembrane domain M 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s24020.1|PACid:18211172
Sequence length 471
Sequence
MVLIKIGLEGTMEEMQRRLKEAAVEGNVIALLKLLEEDKLVLDGCATDCFTETPLHISAM
LGHLEFTRKILCRKPEFAKELDFLGSSPLHLATANGHLEVVRALLSVNPDMCFAQNRDGR
NPLHIAVIKGRVDVLKELVQNKPEAVLHRTARGETVLHLCVKHFQLEALKLLVETIKDYG
FINSKDEDGSTVLHLAVADKEIEIISFLIMKTEIEVNAINASGFTVLDIALAQGRRNWKD
VDVQDSLHQVGASSAKDLSSTMHRLEAVGAVNLRSEDHFTSLQSRLKRKYQRRQSYGLGE
KRNALMIVASLIATMAFQAGISPPGGLWQEDSQGATSNEHHEAGRSIMADKLPAAYNKFV
MHNSIAFLASLSVILLLISGLPFRWRFSMWILTAIMWVAITESTFTYLISIYCLSSLHQR
RTYIVTVVVLSVVMLGLLSVLLVGHSVRLIAKIVKLGRRLMAPRDRRILFE
Download sequence
Identical sequences B9HDA7
XP_002309480.1.11743 POPTR_0006s24020.1|PACid:18211172 3694.eugene3.00061573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]