SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s28990.1|PACid:18212057 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s28990.1|PACid:18212057
Domain Number 1 Region: 18-135,232-326,640-850
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.31e-88
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 328-638
Classification Level Classification E-value
Superfamily HAD-like 1.57e-38
Family Meta-cation ATPase, catalytic domain P 0.00083
Further Details:      
 
Domain Number 3 Region: 135-232
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.06e-29
Family Calcium ATPase, transduction domain A 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s28990.1|PACid:18212057
Sequence length 955
Sequence
MSSKGGISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKE
SKILKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEEN
NAGNAAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLK
IDQSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
FQKVLTAIGNFCICSIAVGIIAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV
TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDTSLIEVFAKGVEK
EHVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSD
GNWHRASKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGA
PWQLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS
ALLGQDKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPA
LKKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR
IVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIV
LGGYMALMTVLFFWIMKDTDFFSDKFGVRSLRNNDEEMMAALYLQVSIVSQALIFVTRSR
SWSFVERPGFLLLGAFVAAQLVATLIAVYANWGFARIEGCGWGWAGVIWLFSVVTYVPLD
ILKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMF
SEKNSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV
Download sequence
Identical sequences B9N695
XP_006382164.1.11743 3694.estExt_fgenesh4_pg.C_1470038 POPTR_0006s28990.1|PACid:18212057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]