SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0007s09790.1|PACid:18243561 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0007s09790.1|PACid:18243561
Domain Number 1 Region: 117-236,336-447,805-1011
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.27e-102
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 451-471,608-860
Classification Level Classification E-value
Superfamily HAD-like 3.41e-56
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 3 Region: 459-664
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.34e-49
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0023
Further Details:      
 
Domain Number 4 Region: 238-333
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.14e-24
Family Calcium ATPase, transduction domain A 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0007s09790.1|PACid:18243561
Sequence length 1012
Sequence
MERLVSGDFDVKAKHSSEEALQKWRKLCGVVKNPKRRFRFTANLSKRYEAAAMRKTNQEK
LRIAVLVSKAAFQFIQGVSPSDYNVPAEVKAAGFDICADELGSIVEGHDVKKIKFHGGVT
GVSEKLCTSIVDGLTTTDSDLLNRRQEIYGINKFAESQPRSFWIFVWEALQDMTLMILGV
CAFVSLIVGIATEGWLEGTHDGLGIVASILLVVFVTAISDYRQSLQFRDLDTEKKKIIIQ
VTRNGFRQKLSIYDLLPGDIVHLAIGDQVPADGLFVSGFSVLIDESSLTGESEPVMVNSE
NPFMLSGTKVQDGSCKMMVATVGMRTQWGKLMATLSEGGDDETPLQVKLNGVATIIGKIG
LFFAVVTFAVLVQGLFSHKWQAGTYFRWSGDDALEILEYFAIAVTIVVVAVPEGLPLAVT
LSLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVKSCICMEVKVVD
QPTKAASLVSEMPVSAVKLLLQSIFNNTGGEVVVNKDGKREILGTPTETALLEFALSLGG
DFQAERQAVKLVKVEPFNSTKKRMGVVMELHEGGLRAHTKGASEIVLAACDKVINSNGDI
VPLDEESTNLLKDTIDQFANEALRTLCIAYMELEGGFSPENPMPVSGYTCIGIVGIKDPV
RPGVKESVAVCRSAGITVRMVTGDNINTAKAIARECGILTDDGIAIEGPDFREKSLEELL
QLVPKIQVMARSSPLDKHTLVKHLRTTFGEVVAVTGDGTNDAPALHEADIGLAMGIAGTE
VAKESADVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNVVALIVNFSSACLTGSA
PLTAVQLLWVNMIMDTLGALALATEPPNEELMKRSPVGRKGNFISSVMWRNILGQSLYQF
MVIWHLQAKGKALFSLDGPDSDLVLNTLIFNSFIFNEISSREMEEIDVFKGILDNYVFVA
VIGGTVLSQIIIVEFLGTFANTTPLTFAQWFLSVLIGFLGMPIAAGLKKIPV
Download sequence
Identical sequences U5GAC3
XP_006380610.1.11743 POPTR_0007s09790.1|PACid:18243561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]