SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0007s10480.1|PACid:18243314 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0007s10480.1|PACid:18243314
Domain Number 1 Region: 391-411,466-723
Classification Level Classification E-value
Superfamily HAD-like 8.25e-39
Family Meta-cation ATPase, catalytic domain P 0.0023
Further Details:      
 
Domain Number 2 Region: 196-247,288-387,673-706
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000392
Family Calcium ATPase, transmembrane domain M 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0007s10480.1|PACid:18243314
Sequence length 767
Sequence
METTTLRHAIGVTDFPSPSLSLSAAANNNYYYHSSKLLVRKRVIYHQSSLSSKFPFNSLS
HPPRSTNFNHRFILRATGHDHHHDHHDHDHDHCCHHHHHEGGHDSQLTGPQRALLKFAKT
LGWMDLANLLREHLQLCCCSAALFITAAACPYIIPKPAVKPLQNALMLVAFPLVGVSASL
DALTDIVGGKVNIHVLMALAGFASIFMGNALERRVLLCMFNLAHIDCEVFQGNATITIEH
LTGEVKPLEAKVGDRIPGGARNVDGRMIVKATKTWKESTLSRIVQLTEEAQSSKPKLQRW
LDEFGEQYSKVVVGLSIAIALLGPFLFKWPFMSTSVCRGSVYRALGLMVAASPCALAVAP
LAYATAISSCARKGILLKGGQVLDALASCHTIAFDKTGTLTTGGLMFKAIEPIYGHLIRN
NRTNFTSCCIPSCEKEALAVAAAMEKGTTHPIGRAVVDHSIGKDLPSVSVDSFEYFPGKG
LVATLNNIESGTGGGKLLKASLGSVEFIASLCKSEDESRKIKEAVNASSYGRDFVHAALS
VEEKVTLIHLEDRPRPGVSDVISELQDQARFRVMMLTGDHESSAWRVAKAVGISEVYCSL
KPEDKLNQVKGISRDMGGGLVMVGEGINDAPALAAATVGIVLAQRASATAIAVADVLLLR
DTISGVPFCIAKSRQTTSLIKQNVALALTSIFLASLPSVLGFLPLWLTVLLHEGGTLLVC
LNSIRALNDPKWSWRYDLQQVVEKLKSRVMLKVTGDTSSSTVEAAPL
Download sequence
Identical sequences POPTR_0007s10480.1|PACid:18243314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]