SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0007s14400.1|PACid:18242928 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0007s14400.1|PACid:18242928
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000824
Family Calcium ATPase, transmembrane domain M 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0007s14400.1|PACid:18242928
Sequence length 87
Sequence
MQTLIFNLVRTENIPFIQEISSLPVICSTVVNSAIGIAVPFTVIGEIMGFTDFPLSHFGF
LVVLFIGYFTVGQVVKRVYILIYKKWL
Download sequence
Identical sequences U5G8L3
XP_006380809.1.11743 POPTR_0007s14400.1|PACid:18242928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]