SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s01520.1|PACid:18249517 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s01520.1|PACid:18249517
Domain Number 1 Region: 136-223,365-413,440-500,975-1193
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.18e-49
Family Calcium ATPase, transmembrane domain M 0.036
Further Details:      
 
Domain Number 2 Region: 501-517,708-814,882-981
Classification Level Classification E-value
Superfamily HAD-like 1.1e-31
Family Meta-cation ATPase, catalytic domain P 0.08
Further Details:      
 
Domain Number 3 Region: 219-290,323-360
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.23e-17
Family Calcium ATPase, transduction domain A 0.0059
Further Details:      
 
Domain Number 4 Region: 512-542,579-780
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.64e-17
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s01520.1|PACid:18249517
Sequence length 1228
Sequence
MATERALLIPSPRTPNITQDLPSLPVSSNSEVKVNLDNPRLVSGMDSQNPTESSSSYEIS
LKSASRRSLSSNPSRASRGNSIGAGSFRDLGSKPVMLGSRRGDSEVFSASQKEISDEDAR
LVYLNDPAKSNERFEFTGNSVHTAKYSLISFIPRNLFEQFHRVAYVYFLIIAVLNQLPQL
AVFGRTASILPLAFVLLVTAVKDAFEDWRRHMSDRIENSRLAWVLVNDQFQEKKWKDIQV
GEIIKIQANDTLPCDMVLLSTSDSTGVAYVQTINLDGESNLKTRYAKQETLSKIPEKEKI
SGLIKCEKPNRNIYGFQANMDIDGKRLSLGPSNIILRGCELKNTSWAIGVAVYCGRETKA
MLNNSGASSKRSWLETRMNSEIIVLSVFLIALCTVVSISAAVWLGRHRDELDTIPFYRRK
RFNEADPKNYNYYGWAAEIVFTFLMSIIVFQIMIPISLYISMELVRVGQAYFMIRDTQMY
DEASNSRFQCRALNINEDLGQIKYVFSDKTGTLTENKMEFQCASVWGVDYSDGKANTQNQ
QARYSVKVDGKVVRPKMTVKVDPQLLELSRSERDTEEIKHVHDFFLALAACNTIVPLIVE
DKSDPTMKLMDYQGESPDEQALAYAAAAYGFMLVERTSGHIVIDIHGERQRFNVFGLHEF
DSDRKRMSVILGCPDSIVRVFVKGADSSMLSVIDRSLNKNVIQTTKGHLHAYSSLGLRTL
VIGMRDLSESEFEEWHFSFEAASTAVVGRAALLRKVAGNVEKSLTILGASAIEDKLQKGV
PEAIESLRTAGIKVWVLTGDKQETAISIGYSSKLLTNKMTQIIINSNSRQSCRKCLEDAL
VMSKNLGTVSETSDNTGTSSEAARSLVALIIDGTSLVYILDSELEAQLFQLASTCSVVLC
CRVAPLQKAGIVALVKKRTTDMTLSIGDGANDVSMIQMADVGVGISGQEGRQAVMASDFS
MGQFRFLVPLLLVHGHWNYQRMGYMILYNFYRNAVFVFVLFWYALFACFTLTTAINEWSS
MLYSIIYTSLPTIVVAIFDKDLSRRNLLQYPQLYGAGQRQEAYDRKLFWLTMSDTLWQSV
VVFFVPLFAYWASTIDVPSIGDLWTLAVVILVNLHLAMDIIRWNWIFHAVIWGSIVATFI
CVMILDAFPMFAGYWAIFNIMGEGSFWVCLFIIIIAALLPRFVVKVLYQYFTPDDIQIAR
EAEKFGNLRDIPVEVEMNPIMEPSSPRR
Download sequence
Identical sequences B9HKJ9
XP_002311928.1.11743 POPTR_0008s01520.1|PACid:18249517 3694.fgenesh4_pg.C_LG_VIII000123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]