SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s06970.1|PACid:18249456 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s06970.1|PACid:18249456
Domain Number 1 Region: 58-170,318-366,398-425,537-676
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-29
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 2 Region: 1008-1055
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000136
Family SNARE fusion complex 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s06970.1|PACid:18249456
Sequence length 1063
Sequence
MFSKLFQKHTAQQQPPSPQQQPPPQPQSPPAKDNVSKGGLTLKDINPRIALHYGIPSTAS
VLAFDHIQSLLAIGTLDGRIKVIGGDSIEGLLVSPKTLPFKYLEFLQNQGILVSVSSDNE
IQVWDLEQRQIASTLQWDSNITAFSVIFASSYMYIGDEYGMVYVLKYDAEEVKLVQMPYH
VPADVAEDASGMSSPKNHSVVGVLPQPSSQGNKHVDWTLASGPSVRFGDLVIMLVLLSAY
MMEHVSINVESDTCTICHGDGVLIAYEDGLMILWDVSEDKVVLVKGNKDIELKCEITADS
HKEIGHKLSDDRSDYEPLEKEIAALCWASTDGSVLAVGYVDGDILLWNLSSTASATDKHA
AKSSNDVVKLQLSTDRVMSVEASSLSMVILSLDWSSGIESLKCIGRVDLTLNGSFADMVV
LPSGGLMGTSGTLVLTNPGQLHFYNDAGLSSSTSLQETRNYVSSMQYPMVIPTIEPQLTA
AKFGLVFRDGKFSKALSEAISARKPQATHSSGNTNWPLTGGVPSQLHDAEKYQVERLYIA
GYQDGTVRIWDATFPTFALIYVLGPEVKGINVANVNASVSALDFCSTTLCLAIGNECGTV
RLYKLVCSADEMSLKFVTETEKEVYTLDQEDGPQCTAVFSFLSSPIYALQFANSGTRLAV
GFHCAQVAMLDTSTSSVLFLTDSLSGSSLPVKSLAVFSNCIDLINNSEDTGSTIVEDHKS
DTKSESAPAASCSESSPLKVDHEASAKAARFKQREENFLLLFCCEDALHLHSLNEVPFSV
DSDPIRKVNLMKPCCWSAPFKKDDKECGIILLYQTGEIEIRSLPDLEVVVESSLMSILRW
NFKTNMEKTICPSENAQIILVNGCEFAAISLLASENHFRIPESLPCLHDKLLTAAADATI
SLSPNQKITQGASSGILGGLIKGFPGSKAEHHVDLLEVCKNDFAHLESIFSSPPFLKPSI
DHADGQKVVELSIDKGTERERLFEGASTDSQPKLRTADEIKAKYRKGDASAAAAHAKDKL
IQRQEKLERLSERTAELQSGAENFASMANELAKQMEKRKWWNI
Download sequence
Identical sequences B9HHQ9
POPTR_0008s06970.1|PACid:18249456 XP_002312164.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]