SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s09050.1|PACid:18248105 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s09050.1|PACid:18248105
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily t-snare proteins 3.69e-24
Family t-snare proteins 0.0006
Further Details:      
 
Domain Number 2 Region: 131-190
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.75e-17
Family SNARE fusion complex 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s09050.1|PACid:18248105
Sequence length 223
Sequence
MSEVFEGYERQYCELSANLSRKCNSTSLLPDGVEKNAKVNEIKSGLDDCDVLIRKMDLEA
RSLQPSVKAMFLAKLREYKSDLNKLKREFKRITSGDVSQASREELLEAGMADAHSVSTDQ
RERLTMSVERLNQSSDRIKESRRAMLETEELGVSVLEDLHQQRQTLLHAHNKLHGVDDAI
DKSKKVLSSMSRRMTRNKWIVGSVIAALVVAIIFIILFKTSYH
Download sequence
Identical sequences U5G7Q6
XP_006379675.1.11743 POPTR_0008s09050.1|PACid:18248105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]