SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s09050.2|PACid:18248106 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s09050.2|PACid:18248106
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily t-snare proteins 2.51e-24
Family t-snare proteins 0.0006
Further Details:      
 
Domain Number 2 Region: 131-174
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000036
Family SNARE fusion complex 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s09050.2|PACid:18248106
Sequence length 189
Sequence
MSEVFEGYERQYCELSANLSRKCNSTSLLPDGVEKNAKVNEIKSGLDDCDVLIRKMDLEA
RSLQPSVKAMFLAKLREYKSDLNKLKREFKRITSGDVSQASREELLEAGMADAHSVSTDQ
RERLTMSVERLNQSSDRIKESRRAMLETEELGVSVLEDLHQQRQTLLHAHNKMMLLTRVR
KSYLPCQEE
Download sequence
Identical sequences B9HIA7
XP_002312263.1.11743 POPTR_0008s09050.2|PACid:18248106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]