SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s09330.1|PACid:18249705 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s09330.1|PACid:18249705
Domain Number 1 Region: 80-151
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.41e-19
Family SNARE fusion complex 0.0018
Further Details:      
 
Domain Number 2 Region: 214-280
Classification Level Classification E-value
Superfamily SNARE fusion complex 8.86e-17
Family SNARE fusion complex 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s09330.1|PACid:18249705
Sequence length 282
Sequence
MFGFRKSPANNKPTKQSSVNPPASFTSNPFDSDDESNAKQTLHHGKRTYSEPMLNVPNDA
FDDRDGYKNDFRDSGGLENQSVQELEKYATYKAEETTKSVNNCLRIAEDIRQDATRTLDM
LHAQGEQITRTHNMAVDMDKDLGKGEKLLNNLGGIFSKPWKPKKTRDITGPLITADKPSK
LNQYNRGEREKLGLAPRGRSAPTTPPPEPTNALQKVEAEKGKQDDALSDLSNILGDLKGM
AIDMGSELDSQNKSLDHLSDDVDELNSRVKGANQRARRLLGK
Download sequence
Identical sequences A9PB46
POPTR_0008s09330.1|PACid:18249705 3694.eugene3.00080873 XP_002312278.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]