SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s15890.1|PACid:18248950 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s15890.1|PACid:18248950
Domain Number 1 Region: 70-183,284-402,764-971
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.1e-118
Family Calcium ATPase, transmembrane domain M 0.00079
Further Details:      
 
Domain Number 2 Region: 406-426,559-819
Classification Level Classification E-value
Superfamily HAD-like 1.34e-57
Family Meta-cation ATPase, catalytic domain P 0.0004
Further Details:      
 
Domain Number 3 Region: 414-619
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.19e-39
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0025
Further Details:      
 
Domain Number 4 Region: 184-282
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.05e-26
Family Calcium ATPase, transduction domain A 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s15890.1|PACid:18248950
Sequence length 984
Sequence
MSHLLHANLVCIERLLDVPATLSKPNKRWHLAFVTIYYIDHFKIHQSSLSELVKKKDLDQ
LENFGGIVRIASAIGTDIDGGIYGGPEDIDRRQQAFGSNTYKKPPTKGFFHFVVEAFKDL
TIAILLGCAALSLGFGIKEHGLKEGWYDGGSIFVAVFLIIAVSAISNYRQNRQFDKLSKI
SNNIQIDVVRSGRRQEVSIFELVVGDVVCLKIGDQVPADGLFIDGHSLQIDESSMTGESD
HVEINHKKNPFLVSGTKVADGYGQMLVTSVGMNTTWGEMMSHISRDTNEQTPLQARLNKL
TSSIGKVGLAVAFLVLLVLLVRYFTGNTQDESGKKEFNGSKTKADDIVNAVVGIVAAAVT
IIVVAIPEGLPLAVTLTLAYSMKRMMKDQAMVRKLPACETMGSATTICTDKTGTLTMNLM
KVTKFWLGQESMEQSNPSPVSPYVLELIKQGVALNTTGSVYRESPESKLEFSGSPTEKAI
LSWAVLELNMNMEQMKQSCTILQVEAFNSQKKRSGVLSMKKMDHTIHVHWKGAAEMILAM
CSSYYDASGLMKEMDDRERNTFKQIIQDMAASSLRCIAFAHKQISEDQYEDGKEDKTLKE
DCLTLLGLVGIKDPCRPGVKKAVDDCQRAGVNVKMITGDNVFTARAIAIECGILKPGAEN
ISGAVVEGEEFRNYTHEQRMEKVDKICVMARSSPFDKLLMVQCLKQKGHVVAVTGDGTND
APALKEADIGLSMGIQGTEVAKESSDIVILDDNFASVATVLRWGRCVYNNIQKFIQFQLT
VNVAALVINFVAAVSAGEVPLTAVQLLWVNLIMDTLGALALATEQPTQELMEKTPVGRTE
PLITNIMWRNLLSQALYQIAILLTLQFKGESIFGVTERVNDTLIFNIFVLCQVFNEFNAR
KLEEKNVFKGIHKNKLFLGIIGITILLQVLMVEFLKKFADTERLNWGQWGACIGTAALSW
PICWVVKCIPVPEKPIFSYLTWRK
Download sequence
Identical sequences B9HKB8
XP_002312557.1.11743 POPTR_0008s15890.1|PACid:18248950 3694.fgenesh4_pm.C_LG_VIII000685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]