SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s18530.1|PACid:18249592 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s18530.1|PACid:18249592
Domain Number 1 Region: 60-111
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.0000173
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s18530.1|PACid:18249592
Sequence length 134
Sequence
MPAGVAVIPLALRVHNRDHWFYLALVVLVSACLCALILSTPVATFCALTRAATAGLLIKG
RFLRVSSIESKSSHPMAAALVDYGRWHSVKPKPEDLEEFQKFPGEGIQGKNEVKNICIDN
RKIAHRASGTGEKP
Download sequence
Identical sequences U5G668
XP_006379969.1.11743 POPTR_0008s18530.1|PACid:18249592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]