SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s18700.1|PACid:18249623 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s18700.1|PACid:18249623
Domain Number 1 Region: 12-80
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000068
Family Calcium ATPase, transduction domain A 0.01
Further Details:      
 
Domain Number 2 Region: 93-169
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000144
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s18700.1|PACid:18249623
Sequence length 177
Sequence
MTTPNRPRYCAYMCNTREEVDVDEVKLNTVLAVKAGEVIPIDGVVDGNCEVDEKTLTGGS
FPVTKQVDSVVWVGTVNLNAEDCVAAKMAKLVEEARNSKSKTRRFIDKFAQYYTPAVIFM
PAGVALIPVALRVHNRDHWFYLALIVLVSACPCALILSTPVATFCALTRVSIKIIKS
Download sequence
Identical sequences B9NC21
3694.eugene3.02810002 POPTR_0008s18700.1|PACid:18249623 XP_006379989.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]