SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s02410.1|PACid:18227760 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s02410.1|PACid:18227760
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily SNARE-like 1.56e-31
Family Synatpobrevin N-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 121-187
Classification Level Classification E-value
Superfamily SNARE fusion complex 9.42e-20
Family SNARE fusion complex 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s02410.1|PACid:18227760
Sequence length 220
Sequence
MAIIYAVVARGTVVLSEFSAVTGNSGAVARRILEKLPSEADSRLCFSQDRYIFHILRSDG
LTYLCMANDTFGRRIPFSYLEDIQMRFMKNYGRVAHHAPAYAVNDEFSRVLHQQMEFFSS
NPSADTLSRVRGEVGEIRTIMVENIEKILERGDRIELLVDKTATMQDGAFHFKKQSKRLR
RALWMKNAKLLALLTCVIVLLLYIIIAACCGGITLPSCRS
Download sequence
Identical sequences B9HPW6
3694.grail3.0001126501 POPTR_0009s02410.1|PACid:18227760 XP_002313491.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]