SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s03070.1|PACid:18227568 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s03070.1|PACid:18227568
Domain Number 1 Region: 27-151,266-376,782-1046
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 9.42e-135
Family Calcium ATPase, transmembrane domain M 0.0000000228
Further Details:      
 
Domain Number 2 Region: 380-400,572-836
Classification Level Classification E-value
Superfamily HAD-like 3.16e-53
Family Meta-cation ATPase, catalytic domain P 0.0000289
Further Details:      
 
Domain Number 3 Region: 389-630
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.89e-49
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00016
Further Details:      
 
Domain Number 4 Region: 150-261
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.22e-27
Family Calcium ATPase, transduction domain A 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s03070.1|PACid:18227568
Sequence length 1064
Sequence
MGKGGEDYGERDQNGIESQNQGDIFPAWAKEVKECEEKYAVNREFGLSSADVEKRLKIYG
YNELEKHEGVSIFKLILDQFNDTLVRILLAAAIVSFVLAWYDGEEGGEMGITAFVEPLVI
FLILIVNGIVGIWQESNAEKALEALKEIQSEHATVIRDRKKFSSLPAKELVPGDIVELRV
GDKVPADMRVLNLISSTLRVEQGSLTGESEAVSKTAKPVAESTDIQGKKCMVFAGTTVVN
GNCICLVTETGMNTEIGKVHSQIHEAAQNEEDTPLKKKLNEFGEVLTMLIGIICALVWLI
NLKYFLTWEYVDGWPKNFKFSFEKCTYYFEIAVALAVAAIPEGLPAVITTCLALGTRKMA
QKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMAVSKLVAMGSRVGTLRSFNVEGTTYS
PFDGKIEDWPVGRMDSNLQMIAKIAAVCNDAGVEQSGNHYVAGGMPTEAALKVMVEKMGF
PGGLSKESSLVHEDVLACCRLWNTMEQRIATLEFDRDRKSMGVIVNSSSGKKSLLVKGAV
ENLLDRSTSIQLLDGSVVALDRCSKDLILQNLREMSTSALRCLGFAYKEDLSEFRTYSGD
EDHPAHQLLLDLHNYSSIESNLTFVGLAGLRDPPRKEVRQAIEDCKAAGIRVMVITGDNK
NTAEAICHEIGVFGPYDDISSKSLTGREFMGLRDKKTHLRQSGGLLFSRAEPRHKQEIVR
LLKEDGEVVAMTGDGVNDAPALKLADIGIAMGIAGTEVAKEASDMVLADDNFSTIVVAVG
EGRSIYNNMKAFIRYMISSNIGEVASIFLTAALGIPEGMIPVQLLWVNLVTDGPPATALG
FNPPDGDVMKKPPRKSDDSLISAWILFRYLVIGFYVGIATVGVFIIWYTRHTFMGIDLSG
DGHSLVTYSQLANWGHCESWKNFSASPFTAGSQVFNFDANPCEYLRSGKIKASTLSLTVL
VAIEMFNSLNALSEDCSLVRMPPWVNPWLLLAMSVSFGLHFLILYVPFLAQVFGIVPLSL
NEWLLVLAVALPVILIDEVLKFVGRLTSGWRHSGSRRPSKSKPE
Download sequence
Identical sequences B9HPP7
3694.fgenesh4_pg.C_LG_IX001309 XP_002314209.1.11743 POPTR_0009s03070.1|PACid:18227568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]