SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s00430.1|PACid:18241153 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s00430.1|PACid:18241153
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.8e-17
Family SNARE fusion complex 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s00430.1|PACid:18241153
Sequence length 260
Sequence
MASELQMSPQLEQIHGEIKDNFRALSNGFQRLNNIKDSNRQSKQLEELTGRMKECKRLIK
EFDREIKVEESKNPPEVNKQLNDEKQSMIKELNSYVQLRKTYMNSLDNKRVELFDMGAGA
SEPMAEENVRMASAMSNQELVDAGMKTMNETDQAIERSKQVVEQTIEVGTQTAGTLKGQT
EQMGRIVNELDTIQFSIKKASQLVKEIGRQVATDKCIMLFLLLIVCGVIAIIIVKIVNPS
NKDIRDIPGLAPPAPSRRLL
Download sequence
Identical sequences B9HXA1
POPTR_0010s00430.1|PACid:18241153 3694.estExt_fgenesh4_pm.C_LG_X0012 XP_002314329.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]