SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s03310.1|PACid:18240888 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s03310.1|PACid:18240888
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-24
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s03310.1|PACid:18240888
Sequence length 93
Sequence
MNHFHIYEAIGRGKYSSVYKGRKKKTIEYFAVKSVDKSQKRKVLHEVRMLHSLDHSNVLK
FYSWYETPSHLWLVLEYCVGGDLMTLLRQVETV
Download sequence
Identical sequences B9HY53
POPTR_0010s03310.1|PACid:18240888 3694.eugene3.00100191 XP_002314398.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]