SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s04910.1|PACid:18239697 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s04910.1|PACid:18239697
Domain Number 1 Region: 57-144,277-404,891-1114
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.01e-49
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 
Domain Number 2 Region: 398-422,628-741,806-885
Classification Level Classification E-value
Superfamily HAD-like 5.57e-34
Family Meta-cation ATPase, catalytic domain P 0.058
Further Details:      
 
Domain Number 3 Region: 417-446,475-636,669-680
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.09e-23
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0089
Further Details:      
 
Domain Number 4 Region: 142-211,246-285
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.84e-17
Family Calcium ATPase, transduction domain A 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s04910.1|PACid:18239697
Sequence length 1208
Sequence
MSGGWERLRGSRSRTTRDSSFHTPAPSRTVTLGRVQPQAPGHRTIYCNDRDANLPVRFKG
NSISTTKYNFFTFVPKGLFEQFRRVANCYFLLISILSMTPISPVNPVTNVVPLSLVLLVS
LIKEAFEDWKRFQNDMVINNSLIDVLQDDKWVAVPWKKLQVGDIVRVKKDGFFPADLLFL
ASTNADGVCYTETANLDGETNLKIRKALERTWDYLTPDKAAEFKGEMQCEQPNNSLYTFT
GNLIFQKQTLPLTPNQILLRGCSLRNTEYIVGAVIFTGHETKRSTLERKLDKLILALFAT
LFIMCLIGAIGSGIFINRKYYYLRLDKAVAAEFNPGNRFVVAALTLFTLITLYSTIIPIS
LYVSIEMIKFIQSTQFINKDLHMYHAETNTPASARTSNLNEELGQVEYIFSDKTGTLTRN
LMEFFKCSIGGEVYGSGVTEIELGGAQRTGIKFQEVRKSSTAIQEKGFNFDDHRLMRGAW
RNEPNSDTCKEFFRCLAICHTVLPEGDESPEKITYQAASPDEAALVTAAKNFGFFFYRRT
PTMIHVRESHVEKMGKIQDVAYEILNVLEFNSTRKRQSVVCRYPNGRLVLYCKGADTVIY
ERLAAGNDDLKKVTRAHLEQFGSAGLRTLCLAYRDLSPETYESWNEKFIQAKSSLRDREK
KLDEVAELVEKDLILIGSTAIEDKLQEGVPACIETLSRAGIKVWVLTGDKMETAINIAYA
CNLINNDMKQFIISSETDAIREVENRGDQVEIARFIKEEVKKELKKCLEEAQHYLRTVSG
PKLALVIDGKCLMYALDPTLRVMLLNLSLNCHSVVCCRVSPLQKAQVTSLVKKGARKITL
SIGDGANDVSMIQAAHIGIGISGLEGMQAVMASDFAIAQFRFLTDLLLVHGRWSYLRICK
VITYFFYKNLTFTLTQFWFTFQTGFSGQRFYDDWFQSLYNVIFTALPVIIVGLFDKDVSA
SLSKKYPELYKEGIRNVFFKWRVVITWACFSVYQSLVFYHFVTISSASGKNSSGKIFGLW
DISTMAFTCVVITVNLRLLMICNSITRWHYISVGGSILAWFMFIFIYSVLRENVFFVIYV
LMSTIYFYLTVLLVPIVALLGDFIYQGIQRCFFPYDYQIVQEIHRHEPDDNTRAGLLEVA
SQLTPQEERSYAISQLPREISKHTGFAFDSPGYESFFAAQLGVYAPQKAWDVARRASMKS
KPKMPKRN
Download sequence
Identical sequences B9HU80
XP_002314626.2.11743 POPTR_0010s04910.1|PACid:18239697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]