SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s09130.1|PACid:18241051 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s09130.1|PACid:18241051
Domain Number 1 Region: 50-168,529-736
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.62e-93
Family Calcium ATPase, transmembrane domain M 0.00095
Further Details:      
 
Domain Number 2 Region: 172-192,324-584
Classification Level Classification E-value
Superfamily HAD-like 3.23e-58
Family Meta-cation ATPase, catalytic domain P 0.00024
Further Details:      
 
Domain Number 3 Region: 180-384
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.98e-38
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0021
Further Details:      
 
Domain Number 4 Region: 1-48
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000131
Family Calcium ATPase, transduction domain A 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s09130.1|PACid:18241051
Sequence length 749
Sequence
MTGESDHVEINHKKNPFLVSGTKVADGYGQMLVTSVGMNTTWGEMMSHISRDTDEQTPLQ
ARLNKLTSSIGMVGLTVAFLVLVVLLVRYFTGNTQDESGNKEFNGSKTKADDIVNAVVGI
VAAAVTIIVVAIPEGLPLAVTLTLAYSMKRMMKDQAMVRKLSACETMGSATTICTDKTGT
LTMNLMKVTKFWLGQESMEQSSPSISPYVLELIQQGVALNTTCSAYRESPESKFVFSGSP
TEKAILSWAIHELNMDMEQMKHSFTILYVEAFNSQKKRSGVLSRKKVDNTIHVHWKGAAE
MILAMCSSYYDASGLMKDMDVGERNTFKQIIQVMAANSLRCIAFAHKQLSEEQYEDGKEE
KRLQEDSFTLLGLLGIKDPIRPGVKKAVEDCQHAGVNIKMITGDNVFTARAIAIECGILE
YGAENINGAVVEGEEFRNYTHEQRMEKVDKICVMARSSPFDKLLMVQCLKQKGHVVAVTG
DGTNDAPALKEADIGLSMGIQGTEVAKESSDIVILDDNFASVATVLRWGRCVYSNIQKFI
QFQLTVNVAALVINFVAAVSAGEVPLTAVQLLWVNLIMDTLGALALATEQPTQELMKKTP
VGRTEPLITNIMWRNLLSQALYQIAILLTLQFKGEPIFGLTERVNDTLIFNIFVLCQVFN
EFNARKLEEKNVFKGIHKNKLFLGIIGITILLQVLMVEFLKKFADTERLNWGQWGACIGI
AALSWPIGWVVKCIPVPEKPIFSYLTWKK
Download sequence
Identical sequences B9HUQ4
POPTR_0010s09130.1|PACid:18241051 XP_002314662.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]